PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G277800.1.p
Common Name1-3-1A, GLYMA_10G277800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 234aa    MW: 26517.5 Da    PI: 6.6394
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G277800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445e-14119163347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
  Glyma.10G277800.1.p 119 PWTEEEHRLFLIGLSKFGKGDWRSISRNVVVTRTPTQVASHAQKY 163
                          8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0691062IPR001005SANT/Myb domain
SuperFamilySSF466891.45E-101268IPR009057Homeodomain-like
CDDcd001675.97E-51460No hitNo description
PROSITE profilePS500906.2261460IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.7E-43460IPR009057Homeodomain-like
PROSITE profilePS5129420.947112168IPR017930Myb domain
SuperFamilySSF466894.21E-17114169IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-17115167IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.2E-11116162IPR009057Homeodomain-like
SMARTSM007177.3E-11116166IPR001005SANT/Myb domain
CDDcd001671.68E-9119164No hitNo description
PfamPF002496.3E-12119163IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MFQESSVTRW PTQWTRYHDK LFERALLVVP EDLPDRWEKI ADQVPGKSAV EVREHYEALV  60
HDVFEIDSGR VEVPSYVDDS VAMPPSGGAG ISTWDNANQI SFGSKLKQQG ENERKKGTPW  120
TEEEHRLFLI GLSKFGKGDW RSISRNVVVT RTPTQVASHA QKYFLRQNSV KKERKRSSIH  180
DITTVDSNSA PMPIDQTWVP PPGGSLQQSQ QYPSSNMHDQ MGTFGYSNYG FDM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1314761173RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.1930.0flower| meristem| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO199115760.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0830270.0AB083027.1 Glycine max mRNA for syringolide-induced protein 1-3-1A, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237360.11e-175syringolide-induced protein 1-3-1A
TrEMBLQ8S9001e-175Q8S900_SOYBN; Syringolide-induced protein 1-3-1A
STRINGGLYMA10G42450.11e-174(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.15e-82MYB family protein
Publications ? help Back to Top
  1. Hagihara T,Hashi M,Takeuchi Y,Yamaoka N
    Cloning of soybean genes induced during hypersensitive cell death caused by syringolide elicitor.
    Planta, 2004. 218(4): p. 606-14
    [PMID:14586656]